Protein Info for Rru_A2204 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF59 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF01883: FeS_assembly_P" amino acids 6 to 78 (73 residues), 45.1 bits, see alignment E=3.1e-15 PF10609: ParA" amino acids 123 to 365 (243 residues), 336.2 bits, see alignment E=3.4e-104 PF09140: MipZ" amino acids 125 to 272 (148 residues), 34.1 bits, see alignment E=5.5e-12 PF13614: AAA_31" amino acids 125 to 163 (39 residues), 35.6 bits, see alignment 2.7e-12 PF01656: CbiA" amino acids 127 to 345 (219 residues), 52.6 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 100% identity to rru:Rru_A2204)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS91 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Rru_A2204 Protein of unknown function DUF59 (NCBI) (Rhodospirillum rubrum S1H)
MASVTRDDVLGALTRIVPPGADHDVVSLGWIDGVAIQPGGLVSVSLAVPAALGPSLEPLS
RQAEDALRALAGVTRATVILTAQRPPQAENAQQRPPQAEKKPQPGAGGHGHATSQARIEL
PGVRHIIAVASGKGGVGKSTTAVNLALGLTALGLKVALFDADIYGPSIPRMLGVASVKPV
ANGKKVMPVTNHGLSMMSIGFMIAEDDPIIWRGPMVMGALEQLLRDVDWGTQDVMVVDMP
PGTGDTQLTMCQRVALSGAVIVSTPQDIALLDAKRGLAMFRRVDVPVLGLIENMSYHLCT
NCGHREDVFSHGGARRTAQELGVPFLGELPLDIRIRSGSDEGMPITLSDPEGDHALAYKA
IARAVWTSLESAAPAAPNVGSQ