Protein Info for Rru_A2201 in Rhodospirillum rubrum S1H

Annotation: Peptidase S1C, Do (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details TIGR02037: peptidase Do" amino acids 48 to 499 (452 residues), 510.1 bits, see alignment E=2.6e-157 PF00089: Trypsin" amino acids 115 to 271 (157 residues), 74 bits, see alignment E=4.2e-24 PF13365: Trypsin_2" amino acids 116 to 250 (135 residues), 126.8 bits, see alignment E=2.8e-40 PF00595: PDZ" amino acids 285 to 350 (66 residues), 40.3 bits, see alignment E=8.5e-14 PF13180: PDZ_2" amino acids 290 to 380 (91 residues), 53.4 bits, see alignment E=6.5e-18 amino acids 412 to 485 (74 residues), 27.6 bits, see alignment E=7.3e-10 PF17820: PDZ_6" amino acids 316 to 351 (36 residues), 39.1 bits, see alignment 1.2e-13

Best Hits

Swiss-Prot: 43% identical to DEGPL_PSEF5: Probable periplasmic serine endoprotease DegP-like (mucD) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 100% identity to rru:Rru_A2201)

Predicted SEED Role

"HtrA protease/chaperone protein"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RS94 at UniProt or InterPro

Protein Sequence (508 amino acids)

>Rru_A2201 Peptidase S1C, Do (NCBI) (Rhodospirillum rubrum S1H)
MFQSVLDRTASNGAGSAGRLRRALAPALVAFSLAIAPFSAQAREIPESFADLAEGLLPAV
VNISTTQTIDADRGPEMPQFPPGSPFEEFFKDFFERHGGPGGGVQPKTPRRATSLGSGFI
VDAAGYIVTNNHVIQDADEITVILHDDTAIKAELVGKDEKTDVALLRIKTDKPLTAVPWG
NSEAARVGDWVMAIGNPFGLGGTVTAGIISAKTRDINAGPYDSFIQTDAAINKGNSGGPL
FNMHGEVIGINTAIFSPSGGSIGIGFSVPSNLAHQVIDDIKKFGRTRRGWIGVRIQSVTD
EIAEGLGLEKSAGALIAAVTPGGPAAAAGLKVGDVIVSFDGRPVPDMRTLPRIVAETEIG
KDAAIGVWREGKRQDLKMKVGELEVAEDEGLLNEPETSGVTDSQGGTAVATIGLTVTKLD
DRLRSQFGFDAASEGVVVTDVTNESDAQEKGLEPGTLIVKINQTEVASPEDVVKAVAKAK
DEGRKTVLLLVELRGTRTFIPVKMADKK