Protein Info for Rru_A2177 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 54 to 77 (24 residues), see Phobius details amino acids 149 to 175 (27 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 244 to 268 (25 residues), see Phobius details amino acids 275 to 300 (26 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details PF12911: OppC_N" amino acids 41 to 88 (48 residues), 31.5 bits, see alignment 1.3e-11 PF00528: BPD_transp_1" amino acids 164 to 357 (194 residues), 92.4 bits, see alignment E=3.1e-30

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to rru:Rru_A2177)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSB8 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Rru_A2177 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MSREDRRVVSFAFSTRPPAGQPDDKGGRAPPLTSEPPPQGPWAVALRKLWRDRAAMVALA
VFLVVCALCLMAPLYAQFIAGSDPFQTNLNGEIVVDGEVRAVLEASTEGLGLGMTPIGPT
WRLGPYMLGADNQGRDVAARLLYGGRDSLLIAGSSTLITLVLATFVGVVAGYFGGVVDGV
LSRFLDILWAFPIYLLAISLSIVLISKGLEIGPISITAGSLALPITIIGIVYVPYVARPI
RGHVLSLMTSEFVLAAVGLGVPSARILLRDILPNVMTRVIVFIPLMMALNMLTESSLSFL
SIGVQPPDASWGTIIQDGQGLLYSRPMVAFAPGLAIVLCVLTLNIFGDGVRDALDPKSKL
RVG