Protein Info for Rru_A2176 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 133 to 150 (18 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 243 to 270 (28 residues), see Phobius details amino acids 291 to 316 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 103 (103 residues), 57.4 bits, see alignment E=1.6e-19 PF00528: BPD_transp_1" amino acids 115 to 321 (207 residues), 124.9 bits, see alignment E=3.3e-40

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to rru:Rru_A2176)

Predicted SEED Role

"permease of oligopeptide ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSB9 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Rru_A2176 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MLTALASRFAQMIFVLVGISMIVFLIFFATPGSDPAARIAGRNASQETLQVVRHDFGLDR
PLPVQYALMMKRLFITGDLTSFVNRGQKVVPTVVNAIPVTLSLVLGAGVLWVVGGVVVGV
LAAMTRGRWLDRVLMILGLIGVSMPVFWLGEVANLVSQSRFHDTFLFSWVPALGYKPFSE
DPAGWFKTLVIPWFTLATLYVGLYGRVLRASLIEVLQEDFIRTARAKGLSERRILLRHGL
RSSLVAFVTMFGLDFGALVGGGALLAEVVFGLQGVGKVTYDAMQNLDLPTIMATVIYASF
FVVFANFIVDVLYAFLDPRVRDAF