Protein Info for Rru_A2171 in Rhodospirillum rubrum S1H

Annotation: Extracellular ligand-binding receptor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 27 to 363 (337 residues), 207.1 bits, see alignment E=9.5e-65 PF13433: Peripla_BP_5" amino acids 27 to 347 (321 residues), 54.4 bits, see alignment E=1.8e-18 PF01094: ANF_receptor" amino acids 48 to 361 (314 residues), 106.6 bits, see alignment E=2.2e-34

Best Hits

Swiss-Prot: 49% identical to LIVB1_BRUME: Leu/Ile/Val-binding protein homolog 1 (BMEI0263) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2171)

MetaCyc: 43% identical to L-leucine/L-phenylalanine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-35-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid ABC transporter, amino acid-binding protein (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSC4 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Rru_A2171 Extracellular ligand-binding receptor (NCBI) (Rhodospirillum rubrum S1H)
MRTLHKAVFSVTVSALAISPLPALADIPVGLALGLTGQIAAIGEQSRRGAEAAIAAFNKA
GGLKGETITLQVEDDACDPKQGVAVANKFVSAGVEAVIGHMCTGPTMAASTVYSEEEIPM
VTASATGPDLTERGLTNVFRATGRDDQQGTIAGKMIAERFADQTTAIVHDKQAYGRGLAE
EAKKAMNAAGKEEALFAAIVPGEQDFSALISRLKQAGVKVVYYGGYYNDLGQIVRQSRAQ
GLDAVFVGGDGLSSSEFWAITGEAGEGTLFTFTPDASTNPAAKEAVEAFKADGKGDADNF
AYYYYAAAQVLTQAMAKAGSADPEAVTKALRDNTFETVAGPMDFDAKGDLTAPAFVFYQW
SAGKPKPAAF