Protein Info for Rru_A2170 in Rhodospirillum rubrum S1H

Annotation: ABC transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 645 PF00005: ABC_tran" amino acids 18 to 175 (158 residues), 81.1 bits, see alignment E=3e-26 amino acids 325 to 456 (132 residues), 74.8 bits, see alignment E=2.7e-24 PF12848: ABC_tran_Xtn" amino acids 214 to 294 (81 residues), 95.4 bits, see alignment E=4.3e-31 PF13304: AAA_21" amino acids 418 to 488 (71 residues), 32 bits, see alignment E=3.4e-11 PF16326: ABC_tran_CTD" amino acids 570 to 627 (58 residues), 36.1 bits, see alignment 1.5e-12

Best Hits

KEGG orthology group: K06158, ATP-binding cassette, sub-family F, member 3 (inferred from 100% identity to rru:Rru_A2170)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSC5 at UniProt or InterPro

Protein Sequence (645 amino acids)

>Rru_A2170 ABC transporter component (NCBI) (Rhodospirillum rubrum S1H)
MLHIKSLTYRIGGRTLLDEATAHIPEGQRIGLIGRNGTGKTTLFRLILGELSGDGGSIAV
RPRARVGQVAQEAPDGDTTLLDCVLAADAERASLLAALEGDTDPHHLGEIHDRLNAIGAH
SAPARAGAILSGLGFSAEAQARAVGEFSGGWRMRVALAAALFSRPDLLLLDEPTNHLDLE
ATLWLEGFLANYPGTLLIISHDRDLLNRAVGRIIHLDNGKLVAYAGNFDRFERTRRERME
HQSKAFVRQTEERKRIQAFVDRFRAKATKARQAQSRLKMLERMQPVEAVVEDSTIPFDFP
DPDQLPPPIVAFDDVAAGYDGVAVLRGVTLRLDMEDRVALLGANGNGKSTLAKVLAGRLA
PLSGEIRMPSKLRIGYFAQHQTDELRMGESPLLHGRRLMGELSDQKIRGHLGRFGFGEDR
VHTPVANLSGGEKARLLIALTCREAPHLLILDEPTNHLDIDSRESLMQALNVFQGAVLLI
SHDPRLVEMVADRLWLVDGGKVTSFEGDMDDYRKLLLERARDARREASSDSANAGEAAAE
GAATSASARQDRRRAAAEARVRLAPLRRVAEKAEAQVDKLTTEKAKIQAALADPALYRGP
KEKVALLQQDLGRVDRALAGAEDAWLSAQEALDSATAAEPALAEG