Protein Info for Rru_A2158 in Rhodospirillum rubrum S1H

Annotation: Two Component, Sigma54 Specific, Transcriptional Regulator, Fis family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 transmembrane" amino acids 122 to 144 (23 residues), see Phobius details PF00072: Response_reg" amino acids 55 to 164 (110 residues), 89 bits, see alignment E=8.5e-29 PF14532: Sigma54_activ_2" amino acids 193 to 363 (171 residues), 68.2 bits, see alignment E=3.3e-22 PF00158: Sigma54_activat" amino acids 193 to 358 (166 residues), 222.4 bits, see alignment E=1.1e-69 PF07728: AAA_5" amino acids 216 to 338 (123 residues), 24.5 bits, see alignment E=8.4e-09 PF25601: AAA_lid_14" amino acids 364 to 441 (78 residues), 75.2 bits, see alignment E=1e-24 PF02954: HTH_8" amino acids 466 to 502 (37 residues), 34.8 bits, see alignment 4e-12

Best Hits

KEGG orthology group: K10912, two-component system, repressor protein LuxO (inferred from 100% identity to rru:Rru_A2158)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSD7 at UniProt or InterPro

Protein Sequence (511 amino acids)

>Rru_A2158 Two Component, Sigma54 Specific, Transcriptional Regulator, Fis family (NCBI) (Rhodospirillum rubrum S1H)
MRLGDFSRYLPGGRRGLFPIYCGVIEGRPRNGGLVRPHKAEEFPSRMTDETLPFILLVED
TPVQARTYLDYLDGGPWTIEHVETGAEALAVLERRPPSLMLLDIHLPDMDGMEILRRVRS
LPLSMGVVMITSNASISLAVAAMQAGANDFLVKPFSRDRLMVTLRNVIDNQRLSREVETL
RENLGIAAFQGFVGSSAAMQRVYRLIEASAASTATVFITGESGSGKELAAEALHRYGPRV
KGPFVALNCGAIPRELMESEVFGHVRGSFTGAVSDRDGAAAQANGGTLFLDEICEMDPNL
QTKLLRFLQTGMVQKVGGDRPEKVDVRIVCATNRDPLEEVKAGRFREDLYYRLHVIPIRL
PALRDREGDVLEIADHFLASIATEEKKSFRGFSPAVAQALLAYDWPGNVRQLINVLRNVV
VLNNGPEVTLGMLPQAIADADGEAIAGEAAEGESPALFRQQDIEPLWVVEKRAVERAIGA
CGGNIPRAAALLRVSPSTLYRKKQAWEEGRH