Protein Info for Rru_A2143 in Rhodospirillum rubrum S1H

Annotation: methyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF01135: PCMT" amino acids 23 to 98 (76 residues), 23.6 bits, see alignment E=9.9e-09 PF02353: CMAS" amino acids 24 to 112 (89 residues), 29.9 bits, see alignment E=8.9e-11 PF13847: Methyltransf_31" amino acids 35 to 158 (124 residues), 38.2 bits, see alignment E=3.1e-13 PF13649: Methyltransf_25" amino acids 40 to 134 (95 residues), 41 bits, see alignment E=6.5e-14 PF08241: Methyltransf_11" amino acids 41 to 138 (98 residues), 33 bits, see alignment E=1.9e-11

Best Hits

Swiss-Prot: 71% identical to YJHP_ECOLI: Uncharacterized protein YjhP (yjhP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2143)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.64

Use Curated BLAST to search for 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSF2 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Rru_A2143 methyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MDIPRIFTISESAHRIHNPFTPEKLATLGAALRLDPGARVLDLGSGSGEMLCSWARDYGL
GGLGVDMSPVFTDQAKRRADALGVADRVAFLHADAAGFVADERVDVAACVGATWIGGGVV
GTIGLLAKSLRPGGIILIGEPYWLKLPPSEEVAKGCRAASLSDFLGLPELVASFGKLDYD
VVEMVLADQDSWDRYEAAKWLTMRRWLAANPDDDFAKEVRAELTSAPERHARYTRDYLGW
GVFALMAR