Protein Info for Rru_A2125 in Rhodospirillum rubrum S1H

Annotation: 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family-like (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 73 to 91 (19 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 172 to 188 (17 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details amino acids 318 to 336 (19 residues), see Phobius details amino acids 346 to 365 (20 residues), see Phobius details PF13231: PMT_2" amino acids 76 to 231 (156 residues), 34.9 bits, see alignment E=9.1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2125)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSH0 at UniProt or InterPro

Protein Sequence (551 amino acids)

>Rru_A2125 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family-like (NCBI) (Rhodospirillum rubrum S1H)
MARFRDELLLASLIALAALILLRGLGNDSLGFPDADRILMDSVFLRDLLVDLPLADPIGY
TKDYFVQYPALSIGYRPPFFPFVAALLQLLVGPEMWATRLALFGFVLVGVASSYFWIRRH
YGPWPAWGATALWLTTPYLAQWGWYTMAELTVLSMALLAANLFDKYLAEGKPALLYWSVL
AVALAAWTKQTALFLLPWFAAMALAEGRFLAILRRREAWIAAFGLGVLLAPLVAMTLMLG
DLNLEQSVGGTNRWTLANWTVRLKTILHHLTPPLLALSVVGAIWAGLKRDRHGLPFALLI
VVVYGVFSYISGKNDRYPIFWVPAFALFAVLPFHFLSQRLPAKATVPALALGVGVLAAYQ
GSLAFTKTPSYATGYKEAAAYVLDSSETPIVFVDAYNNGYFTYFMRALDQGRSMVVLRGD
KLLSSSAINMATKVEVHAEGRQEIEEIFRSLGVSLIVVEERNYTGLDVHDELRRFLKTDS
FELVQAIPIHSNRTVSVLADFPPLGGQDLLVYRYKDAKTLTSGVVSLRLPVVGQTLSVDM
ETMMERRRAHP