Protein Info for Rru_A2117 in Rhodospirillum rubrum S1H

Annotation: UTP--glucose-1-phosphate uridylyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01099: UTP--glucose-1-phosphate uridylyltransferase
  • amino acids 5 to 266 (262 residues), 335.6 bits, E=1.1e-104
• PF00483: NTP_transferase
  • amino acids 12 to 243 (232 residues), 98.4 bits, E=5.2e-32
• PF12804: NTP_transf_3
  • amino acids 12 to 162 (151 residues), 28 bits, E=2.4e-10

Best Hits

Swiss-Prot: 51% identical to GTAB_STAHJ: UTP--glucose-1-phosphate uridylyltransferase (gtaB) from Staphylococcus haemolyticus (strain JCSC1435)

KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 100% identity to rru:Rru_A2117)

MetaCyc: 52% identical to UTP--glucose-1-phosphate uridylyltransferase (Staphylococcus aureus)
UTP-monosaccharide-1-phosphate uridylyltransferase. [EC: 2.7.7.64, 2.7.7.9]

Predicted SEED Role

"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• sucrose biosynthesis II (6/8 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (4/17 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.64 or 2.7.7.9

Sequence Analysis Tools

See Q2RSH8 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Rru_A2117 UTP--glucose-1-phosphate uridylyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MSRRVRKAVFPVAGMGTRFLPATKTMAKEMLPVVDKPLIQYAVEEAAAAGIDHFIFITGR
GKSVLMDHFDHMPELEALLKERGKTDVLENLLGSMPSPGKVFSTRQQQPLGLGHAVWCAR
AFIGDEPFAVLLPDDLVLADTPCIKQLIDAHAQTGGNVVAVEDVPRERTNKYGILDVVED
NGTLARAKGLVEKPDSDKAPSTLAIIGRYVLDPGIFDLLENQNRGAGGEIQLTDAMNAQI
KDVPFHGLRYEGARYDCGDKVGFLQANIAFALERPDMRDAVKAVLADFAKTI