Protein Info for Rru_A2095 in Rhodospirillum rubrum S1H

Annotation: Secretion protein HlyD (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 45 to 349 (305 residues), 261.7 bits, see alignment E=4.1e-82 PF16576: HlyD_D23" amino acids 57 to 269 (213 residues), 87.7 bits, see alignment E=1e-28 PF13437: HlyD_3" amino acids 166 to 262 (97 residues), 46.8 bits, see alignment E=6.9e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2095)

MetaCyc: 30% identical to vibriobactin efflux pump periplasmic adaptor protein (Vibrio cholerae O1 biovar El Tor str. N16961)
TRANS-RXN-502

Predicted SEED Role

"Probable RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSK0 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Rru_A2095 Secretion protein HlyD (NCBI) (Rhodospirillum rubrum S1H)
MRILRQAVLATVLVLGGGAALVGRSWLMPDADGKQSAPALRALPVEVAAVRRARVADRVE
AVGTTRAHQAIAVVPLASGRIVEMPFPPGRKVNKGDVLVRLDDAAQRADVEEAEATLTQV
SRALERARSLRRTQAVAQATVDDLQSNRAAAAARLDRAHKDLADRVIAAPFAGIVGFREL
DVGARVSEGERLTTLDDLSSVDVEFAVPEIHFGRLRPGMAIEATSQAFPGRIFTGAIDRI
DSRIGEVSRAFRVRATLPNPQGLLPSGLFLNVSIVIEERPALMVPEEAIQAEAGGSVVYV
IQGGAVRRQPIVLGQRTGTAVEVRDGLAEGDQVVSRGIQRLRDGSPVTVIGSAG