Protein Info for Rru_A2089 in Rhodospirillum rubrum S1H

Annotation: Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 18 to 121 (104 residues), 75.6 bits, see alignment E=1.9e-25 PF00528: BPD_transp_1" amino acids 37 to 226 (190 residues), 56.3 bits, see alignment E=1.8e-19

Best Hits

Swiss-Prot: 33% identical to YCKA_BACSU: Probable amino-acid ABC transporter permease protein YckA (yckA) from Bacillus subtilis (strain 168)

KEGG orthology group: K10002, glutamate/aspartate transport system permease protein (inferred from 100% identity to rru:Rru_A2089)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSK6 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Rru_A2089 Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (NCBI) (Rhodospirillum rubrum S1H)
MFATLDFDVIARSIGYLFYDGMTFTLGLTLLGTLAGGLLGTALAMLRLSSLPVLPHLATL
YINLMRSMPLVLLIFWVYFMVPYLGQWILGTDRPMQVGTFTSSLLTFTLFEAAYFAEIMR
SGIQSVSRGQTAAAQALGLTYFQSMGHVVLPQAFRAMLPVLLTQVIVLFQDTSLVYVLSI
TDFLGAASKVAQRDGRLVEMYLFAAVVYFAISFAASLLVKRIQARTAIIR