Protein Info for Rru_A2088 in Rhodospirillum rubrum S1H

Annotation: Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 107 to 124 (18 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 205 to 230 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 23 to 129 (107 residues), 65.2 bits, see alignment E=3.1e-22 PF00528: BPD_transp_1" amino acids 44 to 235 (192 residues), 72.8 bits, see alignment E=1.6e-24

Best Hits

Swiss-Prot: 48% identical to GLTJ_ECOLI: Glutamate/aspartate import permease protein GltJ (gltJ) from Escherichia coli (strain K12)

KEGG orthology group: K10003, glutamate/aspartate transport system permease protein (inferred from 100% identity to rru:Rru_A2088)

MetaCyc: 48% identical to glutamate/aspartate ABC transporter membrane subunit GltJ (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSK7 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Rru_A2088 Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (NCBI) (Rhodospirillum rubrum S1H)
MNYTWNWSIFWQLSPEGNGTYLDTLMSGLYWTMATALAAWALALVLGGMIGIMRTLPSKG
LQRLGAAYVEVFRNIPLLVQLFLWYFVLPELLPPSWGLWLKQIPDAPFYTSVVGIGCFTS
ARVAEQIRAGITTLPRGQAMASTALGLTLPQTYRYILLPMALRIVLPPLTSEFLNTVKNT
SVALTISLMELTARTRAMQEFSFQVFEAFAAATLIYVLINVVVVAVMRVIEHRVAVPGFN
VGK