Protein Info for Rru_A2085 in Rhodospirillum rubrum S1H
Annotation: Nitrogen regulatory protein P-II (GlnB, GlnK) (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to GLNB_RHORT: Nitrogen regulatory protein P-II (glnB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)
KEGG orthology group: K04751, nitrogen regulatory protein P-II 1 (inferred from 100% identity to rru:Rru_A2085)MetaCyc: 69% identical to nitrogen regulatory protein PII-1 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Nitrogen regulatory protein P-II" in subsystem Ammonia assimilation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q53044 at UniProt or InterPro
Protein Sequence (112 amino acids)
>Rru_A2085 Nitrogen regulatory protein P-II (GlnB, GlnK) (NCBI) (Rhodospirillum rubrum S1H) MKKIEAIIKPFKLDEVKEALHEIGLQGITVTEAKGFGRQKGHTELYRGAEYVVDFLPKVK IELVIEDALVERAIEAIQQAAQTGRIGDGKIFVYAIEEAIRIRTGERGGDAI