Protein Info for Rru_A2067 in Rhodospirillum rubrum S1H

Annotation: Acyltransferase 3 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 28 to 369 (342 residues), 90.8 bits, see alignment E=4.6e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A2067)

Predicted SEED Role

"putative acyltransferase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSM8 at UniProt or InterPro

Protein Sequence (400 amino acids)

>Rru_A2067 Acyltransferase 3 (NCBI) (Rhodospirillum rubrum S1H)
MNSSTDPAVQSGQAVAAPRADPSEDKLDYIDAVRGWAILLVITCHVGGQFAQMPYPVKLL
TNSGGHGVQLFFLASAITLMMSWSRQTRPFPTATRTFFIRRFLRIAPMYYLGALIYFYLR
PPSGGFDPGQLARSLLFINAWHPAWIPTTGGWMVVPGGWSIGVEFTFYAVFPVLAIVMTT
LPRALALSAAAVVLACVANALALKGLADYPPLAVDGFLYFWFPNQLIVFALGIVLFHVLA
RLKVRRPGKRLTYGLLAGLGGLALVLSQRVASPSYLISPLTLPTMLLMVFVFVGFILVLA
KGAGTVFSHRWLCGLGRLSFSAYVLHFMVIQAVSASGMVDIGATGYRAIGWLVVHWSVTM
IGTLIVAAIAHKLIEQPGMALAKGLTRARGKPLPVAAAAE