Protein Info for Rru_A2064 in Rhodospirillum rubrum S1H

Annotation: FAD dependent oxidoreductase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details PF00890: FAD_binding_2" amino acids 14 to 59 (46 residues), 22.1 bits, see alignment 2.1e-08 PF01266: DAO" amino acids 14 to 403 (390 residues), 218.5 bits, see alignment E=5e-68 PF13450: NAD_binding_8" amino acids 15 to 42 (28 residues), 24.5 bits, see alignment (E = 6.9e-09)

Best Hits

KEGG orthology group: K00285, D-amino-acid dehydrogenase [EC: 1.4.99.1] (inferred from 100% identity to rru:Rru_A2064)

Predicted SEED Role

"D-amino acid dehydrogenase (EC 1.4.99.1) family protein in hydroxy-L-proline catabolic cluster" in subsystem Proline, 4-hydroxyproline uptake and utilization or Respiratory dehydrogenases 1 (EC 1.4.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.99.1

Use Curated BLAST to search for 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSN1 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Rru_A2064 FAD dependent oxidoreductase (NCBI) (Rhodospirillum rubrum S1H)
MPSPADAAPPLPTLVVGAGIIGVCCALALQERGLSVTLIDAKEPGQEASFGNAGCLAASE
ILPMAAPGLAWKVPRWLLDPLGPLALRPGHLPALIPWLLRFLRAGTPQGVIAATAALAPL
ADLSWRLWPELARAHGLAGDIHAQGTLTLYETDAAFQADAAARRVQAEHGIVSEILTPGA
LAEREPDLAPIFRHGVFHPRYAHVSDPAHITAKLAERAVARGAVLVRGRVLGIERGAGRA
RLRLEGGASLEGARVVIAAGAWSGALCRALGHRVLLESERGYNTTLPDPGVRIGCPISSA
EGKFMLSPLDIGLRIGGAAEFAGLTAPANYRRCDALLTVAKRFLPGLRDAGGSRWMGQRP
STPDSLPVIDALPGDGAGVLLAFGHGHLGLTNAPGTAAMIAALACGETAPIDAGAFSLSR
FA