Protein Info for Rru_A2050 in Rhodospirillum rubrum S1H

Annotation: Secretion protein HlyD (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 PF00529: CusB_dom_1" amino acids 65 to 388 (324 residues), 31.7 bits, see alignment E=2.3e-11 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 68 to 403 (336 residues), 288.3 bits, see alignment E=3.1e-90 PF16576: HlyD_D23" amino acids 92 to 321 (230 residues), 40.4 bits, see alignment E=4.3e-14 PF13533: Biotin_lipoyl_2" amino acids 93 to 141 (49 residues), 31.3 bits, see alignment 2.8e-11 PF13437: HlyD_3" amino acids 204 to 318 (115 residues), 29.3 bits, see alignment E=2.5e-10

Best Hits

Swiss-Prot: 48% identical to MDTE_ECOL6: Multidrug resistance protein MdtE (mdtE) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03585, membrane fusion protein (inferred from 100% identity to rru:Rru_A2050)

MetaCyc: 48% identical to multidrug efflux pump membrane fusion protein MdtE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-359; TRANS-RXN-367

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSP5 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Rru_A2050 Secretion protein HlyD (NCBI) (Rhodospirillum rubrum S1H)
MCTVPYSLLTVHAFRRDGTPTHQEMPPMMLSKTFLRLMTTAALSAVLWSCDSQEGGQAAG
GARPAPEVTVITAAPQTLRITERLPGRTVAYRSAEVRPQVNGIILKRLFEEGTEVTEGQQ
LYQIDPATYKAALDSAKAQLAKADATVKSARAKAARYGELVKLKAVSRQDYDDVTATLAE
SVASVADAQATVDAAEINLAYTRVTAPISGRIGRSAVTEGALVTANQATTLATITQLDPI
NVDLTQSSDKLLKLRAQMANGTVQAPERVPVTLQIDNSGTPYGLTGTLQFSEVVVDETTG
TVRLRATFPNPNRILLPGLFVRATVDFGSRENVFLIPQRAVVRDASGKAALWVIGDGDKA
ERRPVTAETTQGTNWVVTEGLKGGERIVIAGLQSMAPGAQVKAVAAPPAGQEAGQPAGGQ
PAPAAK