Protein Info for Rru_A2045 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 188 to 218 (31 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 266 (179 residues), 57 bits, see alignment E=1.1e-19

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to rru:Rru_A2045)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSQ0 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Rru_A2045 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MRSTHTRTGEEKFWITLLWVGAVGVLVFLMAPILAIIPLSFNGGQFLTYPLQGFSLRWYA
AFLTDPVWIRALRNSLIIGIVSTILATGLGTLASLGLVRAKFRGKGLVMAVLLSPMIVPV
VITAVGFYLFFAPLGLTANYPGLILAHTVLAAPFVVISVTATLQGFDMNLARAAASLGAD
QVTTFRRVILPLIAPGVASGALFAFATSFDEVVVVLLVAGPEQRTLPREMFSGIRENISP
TITAVATVLILFSTLLLIALEALRRRNERMRGLAG