Protein Info for Rru_A2039 in Rhodospirillum rubrum S1H

Annotation: conserved hypothetical protein Rv2307c (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF12146: Hydrolase_4" amino acids 74 to 180 (107 residues), 32.1 bits, see alignment E=7.4e-12

Best Hits

Swiss-Prot: 41% identical to Y2307_MYCTU: Uncharacterized protein Rv2307c (Rv2307c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K06889, (no description) (inferred from 100% identity to rru:Rru_A2039)

Predicted SEED Role

"COG1073: Hydrolases of the alpha/beta superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSQ6 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Rru_A2039 conserved hypothetical protein Rv2307c (NCBI) (Rhodospirillum rubrum S1H)
MGFVLCLLALPLALWLIACLALVIFQRALQYRPSLDPLPDPAAAGLAGARGVVLFPLDGL
SLTAWYLPPPPSAEPPRAVALFHGNAGSLIERVHKARMLAGEGLGVLMVEWRGYGGNPGR
PTEAGLLADGRAAIAFLEAQGIDRARQIFYGESLGSGVAFHLAAEGPAPAAVITEGAFTR
AVDVGARRYRWMPVRLLMRDRFDSLAAAQRVTCPVLILHGRQDGVVPFDMGPTLASAVAG
KVSTFFPDQGGHVDLLDHGAQPVIAGFLREGAGGAFRLP