Protein Info for Rru_A2031 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function UPF0075 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03702: AnmK
  • amino acids 13 to 363 (351 residues), 284.9 bits, E=5.2e-89

Best Hits

Swiss-Prot: 100% identical to ANMK_RHORT: Anhydro-N-acetylmuramic acid kinase (anmK) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K09001, anhydro-N-acetylmuramic acid kinase [EC: 2.7.1.-] (inferred from 100% identity to rru:Rru_A2031)

Predicted SEED Role

"Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.-

Sequence Analysis Tools

See Q2RSR4 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Rru_A2031 Protein of unknown function UPF0075 (NCBI) (Rhodospirillum rubrum S1H)
MDLRESDGAVWAVGLMSGTSMDGIDAALLRTDGHQVFEVGPALTVAYDEATRARIRALLG
TPPGRSVAEVADLARDLTERHAEVAARLIGQSGVTPAVVGFHGQTLLHRPEARLSVQIGD
GALLARRLGVAVVNDLRQADVRAGGQGAPLVPAYHLALAKGLARPLAVLNLGGVGNVTWI
GEGDQPPVAFDTGPGNALIDDWMRRRRGVAMDADGALARSGRIDGAALEALLGHDYFRKP
APKSLDRDAFSLEPVNGLSDGDGAATLVAFTAASVARARDWMPAPPKRWLVCGGGRRNGA
IMEALTRGLGVAVDPVEAVGWDGDALEAQAFAFLAVRGARGLPLTWPTTTGAPRPLTGGT
YWPAATVLGASAVAR