Protein Info for Rru_A2009 in Rhodospirillum rubrum S1H

Annotation: Glycerol kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 TIGR01311: glycerol kinase" amino acids 3 to 490 (488 residues), 675.5 bits, see alignment E=1.7e-207 PF00370: FGGY_N" amino acids 4 to 249 (246 residues), 225.4 bits, see alignment E=8.7e-71 PF02782: FGGY_C" amino acids 260 to 446 (187 residues), 150.9 bits, see alignment E=4.4e-48

Best Hits

Swiss-Prot: 100% identical to GLPK_RHORT: Glycerol kinase (glpK) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00864, glycerol kinase [EC: 2.7.1.30] (inferred from 100% identity to rru:Rru_A2009)

MetaCyc: 51% identical to glycerol kinase (Escherichia coli K-12 substr. MG1655)
Glycerol kinase. [EC: 2.7.1.30]

Predicted SEED Role

"Glycerol kinase (EC 2.7.1.30)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or MLST (EC 2.7.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.30

Use Curated BLAST to search for 2.7.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RST6 at UniProt or InterPro

Protein Sequence (495 amino acids)

>Rru_A2009 Glycerol kinase (NCBI) (Rhodospirillum rubrum S1H)
MPFLLAIDQGTTSSRAIVFDHEGQPIARAQKDLVQYFPGDGWVEHDATAIWEDSLAVARE
ALDRADVAAHAISAIGLTNQRETAVLWERASGQPVHNAIVWQDRRTAALCRELKAQGHEA
LVRRKTGLLIDPYFSATKIGWMLDHDPVLRRRAEAGELAFGTVESWLLYKLTGGAVHASD
ATNAARTLLFDIRANRWDEDLLALFRIPAALLPRVVDNAGRFGETLPGLFGAPIPITGMA
GDQHAAMVGQGCFTRGMIKSTYGTGAFALLNIGQTFVESRNQLLTTLAYRLNGQSTYALE
GSIFVAGAAVQWLRDGLRAISSAAETQVLAEAVADTGGCYMVPAFTGLGAPYWDPEARGA
ILGLTRDTSLEQVARAALEAQGYQTRDLLDAMAADSGTKPLALRVDGGMVANDWVCQFLA
DITGIAVERPRVIETTALGAAALAGLGAGVFASPADLGGQWHRDRLFTPHMPASRRESLY
AGWVQAVRRVASDLR