Protein Info for Rru_A2008 in Rhodospirillum rubrum S1H

Annotation: Thiamine biosynthesis protein ThiC (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 455 to 473 (19 residues), see Phobius details PF13667: ThiC-associated" amino acids 21 to 90 (70 residues), 69 bits, see alignment E=2.6e-23 TIGR00190: phosphomethylpyrimidine synthase" amino acids 124 to 574 (451 residues), 655.3 bits, see alignment E=1.8e-201 PF01964: ThiC_Rad_SAM" amino acids 124 to 571 (448 residues), 595.7 bits, see alignment E=4.5e-183

Best Hits

Swiss-Prot: 100% identical to THIC_RHORT: Phosphomethylpyrimidine synthase (thiC) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03147, thiamine biosynthesis protein ThiC (inferred from 100% identity to rru:Rru_A2008)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RST7 at UniProt or InterPro

Protein Sequence (621 amino acids)

>Rru_A2008 Thiamine biosynthesis protein ThiC (NCBI) (Rhodospirillum rubrum S1H)
MTAPFLSSLSPTSPLASATAPFPGSRKVYARPADAPHLRVPFREIILSDPGEAPVRVADP
SGPYSDPEATIDLRQGLARHRASWASARGNSTVTAGRPAPSEGDFEAFPLTYAPLRRRDE
TPFTQLEYARAGVITDEMIYVATRENLGRDSAVAGACARLAGGEAFGAALPAHVTPEFVR
AEIAAGRAIIPANINHPELEPTIIGRNFLVKVNANIGNSALGSSIEDEVAKLVWAIRWGA
DTVMDLSTGKAIHATREWILRNSPVPIGTVPLYQALEKVGGDATRLDWAVFEDTLIEQCE
QGVDYFTIHAGVRLAHIPLTASRTTGIVSRGGSILAKWCLSHHRENFLYERFADICAILR
RYDVAFSLGDGLRPGSVADANDAAQFAELDTLGALTAVAWEHGCQVMVEGPGHVPMHKIK
ANMDRQLATCGEAPFYTLGPLTTDIAPGHDHITSAIGAAMIGWFGTAMLCYVTPKEHLGL
PDRADVKAGVIAYKLAAHAADIAKGHPAAQLRDDAISRARFDFRWSDQFNLGLDPEGARA
FHDETLPHAAHKTAHFCSMCGPKFCSMKISHDIRDGALEGADALTQAGLDQMSATFRASG
GEVHLDAQALDALAWEGKPAR