Protein Info for Rru_A1956 in Rhodospirillum rubrum S1H

Annotation: Haloacid dehalogenase-like hydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00702: Hydrolase" amino acids 6 to 181 (176 residues), 58.6 bits, see alignment E=1.7e-19 PF13419: HAD_2" amino acids 8 to 187 (180 residues), 42.8 bits, see alignment E=9.5e-15 PF13242: Hydrolase_like" amino acids 147 to 213 (67 residues), 56.5 bits, see alignment E=3.2e-19

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to rru:Rru_A1956)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RSY9 at UniProt or InterPro

Protein Sequence (228 amino acids)

>Rru_A1956 Haloacid dehalogenase-like hydrolase (NCBI) (Rhodospirillum rubrum S1H)
MNGLAAMILDRDGTTLDFSAMYLAFMNGLYQRAGLEAPSAADLLRYETWERIIAGELWIG
TQRVLDIVDDIPRRHMDHGLLFPGVAQGLRRARADGLRLILVSAWVGSAATRALLAREGV
LDAFCAVWTADDLGDLPASTSPVPVKQMLVERAVAHLGVDPEHCLMVGDSPDDILAGARL
GMRTAMVRTGNGARFADIILPAPDLVADSLTQLLARLYPPSPLASHAP