Protein Info for Rru_A1939 in Rhodospirillum rubrum S1H

Annotation: Pseudouridine synthase, Rsu (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 PF00849: PseudoU_synth_2" amino acids 4 to 150 (147 residues), 64.4 bits, see alignment E=7.5e-22 TIGR00093: pseudouridine synthase" amino acids 8 to 178 (171 residues), 166.9 bits, see alignment E=1.5e-53

Best Hits

Swiss-Prot: 61% identical to RLUE_ECO57: Ribosomal large subunit pseudouridine synthase E (rluE) from Escherichia coli O157:H7

KEGG orthology group: K06181, ribosomal large subunit pseudouridine synthase E [EC: 5.4.99.12] (inferred from 100% identity to rru:Rru_A1939)

MetaCyc: 61% identical to 23S rRNA pseudouridine2457 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11834 [EC: 5.4.99.20]

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase E (EC 4.2.1.70)" (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12 or 5.4.99.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT06 at UniProt or InterPro

Protein Sequence (199 amino acids)

>Rru_A1939 Pseudouridine synthase, Rsu (NCBI) (Rhodospirillum rubrum S1H)
MPRLILLNKPYDVLSQFTDRAEGRATLASLVPIPGVYVCGRLDRDSEGLLLLTDNGPLQH
HISHPRSKVPKTYRAQVEGVADKAALDRLRQGVTLRDGPARAVTVEAIDEPAGLWPRDPP
IRWRANIPTSWIELTIDEGRNRMVRRMTAAVGLPTLRLIRWSIGDWTLENLPPGSWREET
ASLPARRRPAAKPPRPPRR