Protein Info for Rru_A1923 in Rhodospirillum rubrum S1H

Annotation: Lipid A biosynthesis-like (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details PF07578: LAB_N" amino acids 18 to 88 (71 residues), 116.7 bits, see alignment E=2e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1923)

Predicted SEED Role

"Lipid-A-disaccharide synthase (EC 2.4.1.182)" in subsystem KDO2-Lipid A biosynthesis (EC 2.4.1.182)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.182

Use Curated BLAST to search for 2.4.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT22 at UniProt or InterPro

Protein Sequence (102 amino acids)

>Rru_A1923 Lipid A biosynthesis-like (NCBI) (Rhodospirillum rubrum S1H)
MLIDLGLIAFTLTLWTAIGFLGQIFFSMRFILQWLSSEKARKSVMPVAFWYFSILGGATL
LAYAIHQEDPVFIFGQALGLIIYVRNLVLIRKEKQNAVMAAE