Protein Info for Rru_A1907 in Rhodospirillum rubrum S1H

Annotation: Protein-methionine-S-oxide reductase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 TIGR00357: methionine-R-sulfoxide reductase" amino acids 20 to 145 (126 residues), 161.5 bits, see alignment E=5.5e-52 PF01641: SelR" amino acids 29 to 143 (115 residues), 160.7 bits, see alignment E=6.3e-52

Best Hits

Swiss-Prot: 51% identical to MSRB_ACAM1: Peptide methionine sulfoxide reductase MsrB (msrB) from Acaryochloris marina (strain MBIC 11017)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 100% identity to rru:Rru_A1907)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT38 at UniProt or InterPro

Protein Sequence (157 amino acids)

>Rru_A1907 Protein-methionine-S-oxide reductase (NCBI) (Rhodospirillum rubrum S1H)
MSSNPNQRSAPADFPPPAAKSDKDWRAILTEDQYRVMRHQGTEAAWSSALNGEKRSGAFL
CAACQAPLFASDDKYDSGSGWPSFTRPVDKQAVDTSVDHKLIVPRTEVHCSACGGHLGHV
FEDGPRPTGLRYCINGVALDFKPEAPQATASHTPTDD