Protein Info for Rru_A1903 in Rhodospirillum rubrum S1H

Annotation: inner-membrane translocator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 35 to 57 (23 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 136 to 138 (3 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 16 to 279 (264 residues), 122.8 bits, see alignment E=7.5e-40

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to rru:Rru_A1903)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT42 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Rru_A1903 inner-membrane translocator (NCBI) (Rhodospirillum rubrum S1H)
MDVETLGAIGGAMSRAATPLALAAVGELVTEKAGVLNLGVEGMMLAGAVAAFAVTVATGN
PLLGILAAMAAGMLLALLFGVLTLSLMANQVATGLALTIFGIGLSAFVGRDFVGTPLTAL
APIHLPVLSDIPLIGPLIFGQDPLVYVTFVLVGGVSWFLMRSRAGLIVRAVGENHDAAHA
LGYDVIAIRYRAVLFGGAMGGLAGAYLSLVYTPMWVENMTAGRGWIALALVVFATWKPWR
VLVGAYLFGGVTIVQLHIQGMGGAIPSQLLSMLPYLATIGVLVLISRDALRIRLNAPACI
GKVFHPES