Protein Info for Rru_A1899 in Rhodospirillum rubrum S1H

Annotation: Nucleoside recognition (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 52 to 79 (28 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1899)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT46 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Rru_A1899 Nucleoside recognition (NCBI) (Rhodospirillum rubrum S1H)
MSVFVFLRTSGREGLGVFWTLAKVMIPVMIGVKAVVELGLLPILARAFEPVMALVGLPAA
TGLVWVTALLVNMYGGAAVLLALMPDLHLSGAQVTILGVMILIAHAIPLEQRIAQRAGTG
FLFSTLLRLGGALCLGAILNGVYRAGDWLQGPAPVSMVSSGSSATERGNWAGWITDSLHT
LGVIMIIVVSLVVLLRLMDKLGITARLTALLAPVLGTVGIGGRAMPLTMVGVLLGLSYGG
ALIIREAKAGTIPRRDLFLSICLLSLTHSLIEDTLFIMALGADLTGILLARVVFTLIVIW
ALDKVLRVVPERTAERLLFAKA