Protein Info for Rru_A1877 in Rhodospirillum rubrum S1H

Annotation: Lipoate synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF16881: LIAS_N" amino acids 11 to 58 (48 residues), 29.3 bits, see alignment 1e-10 TIGR00510: lipoyl synthase" amino acids 12 to 304 (293 residues), 379 bits, see alignment E=8.7e-118 PF04055: Radical_SAM" amino acids 73 to 236 (164 residues), 75.3 bits, see alignment E=6.7e-25

Best Hits

Swiss-Prot: 100% identical to LIPA_RHORT: Lipoyl synthase (lipA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 100% identity to rru:Rru_A1877)

MetaCyc: 53% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT68 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Rru_A1877 Lipoate synthase (NCBI) (Rhodospirillum rubrum S1H)
MMDTPIIRHPEKVRRPDNPSPRKPEWIRVRAPVSHEAAEVRQLMRSKNLFTVCEEAACPN
IGECWKRRHATFMILGDICTRACAFCNVRTGKPGHVDDQEPVNLADSVVAMGLKHVVITS
VDRDDLADGGAGHFHRCITEVRSRAPSCSIEVLTPDFRDKPQGALARVVEAGPDVFNHNL
ETVPRLYPTIRPGARYFHSLKLLDRVKTIDPGVFTKSGIMVGLGETREEVLQVMDDMRSA
GVDFLTIGQYLQPTLKHVAVDRFVTPDEFKDYADIARGKGFLMVASSPLTRSSHHADRDF
EDLRKARQDAAATK