Protein Info for Rru_A1875 in Rhodospirillum rubrum S1H

Annotation: Multi-sensor Signal Transduction Histidine Kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 65 to 89 (25 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 104 to 228 (125 residues), 35 bits, see alignment E=6.9e-13 PF00989: PAS" amino acids 107 to 219 (113 residues), 24.8 bits, see alignment E=3.7e-09 PF08447: PAS_3" amino acids 129 to 216 (88 residues), 66.4 bits, see alignment E=4.7e-22 PF00512: HisKA" amino acids 244 to 309 (66 residues), 39.1 bits, see alignment E=1.3e-13 PF02518: HATPase_c" amino acids 354 to 464 (111 residues), 89.2 bits, see alignment E=5.2e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1875)

Predicted SEED Role

"FIG00609059: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT70 at UniProt or InterPro

Protein Sequence (501 amino acids)

>Rru_A1875 Multi-sensor Signal Transduction Histidine Kinase (NCBI) (Rhodospirillum rubrum S1H)
MLFAPPRGTNDPEDFPGEGSDPRTLFPAPLSARLVLLGGLFTLFSTVAITLWLIGLAARY
PDHALLAPVAGGGAVIVTLTGVCLIAFLFRERRHLAAERRLALSEARLQTALENTGDGIW
DWQIPGDVVHLNGALIARLGFPVDTPSPTATWETMIHPEDRPATLAAFHDHLAGKTPSYH
ARYRWKLPDGVMIWVEAKGRVVTRDRSGKPLRMTGTLSDATPQVEAEELMREKSRRLEES
NRDLEQFAYVASHDLQEPLRMVSSYLGLLRRRHGDQLAPEALEFMSYAEDGAKRMSRLIL
DLLEYSRVTTRGEPPETVALAEVIDEARSNLRMIIDETAARIDLLGCDRTVLADRGQVVR
VFQNLIGNALKYRSPDRPPIITLRCGEDEGWVNVSVADNGIGFSPEHAERIFIIFQRLHG
PKAYEGTGIGLSICKRIIERHGGTIEAQGTPGEGALFRFTLPRAPGPSRSTGGAPDNQDR
RRRDQGRGADGRGRDQGRLAP