Protein Info for Rru_A1873 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF6, transmembrane (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 48 to 68 (21 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 138 to 155 (18 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details PF00892: EamA" amino acids 21 to 148 (128 residues), 54 bits, see alignment E=1.1e-18 amino acids 164 to 300 (137 residues), 42.6 bits, see alignment E=3.8e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1873)

Predicted SEED Role

"Permeases of the drug/metabolite transporter (DMT) superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT72 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Rru_A1873 Protein of unknown function DUF6, transmembrane (NCBI) (Rhodospirillum rubrum S1H)
MTALSSPGNSLRRPFGPSASLLMVCGAFLLVGSSVVASKVVTAAFPPFTATAVRFAIAVG
LLIPWMVLSQGWPAWPGRRAVLALGLQALTGCVLFSVLLLEGLRRSGGVEAGLTLGTLPA
VVALLAVPLLGERLDRRIGVAVLLAAGAGALLHGGKGAGGSGWLGPVLLFGAVVCEALFT
LLGKRAVVHLSPVVTATAVSFASLALSLGPALTEQPLAALSSAPAAAWLGALWLGAPVTV
GGFVLFHAGVAGTSGGAAGVASALVPLSAAGLSALLLGEALLPTDLMAGALVLGAILLLA
LPTGKAG