Protein Info for Rru_A1871 in Rhodospirillum rubrum S1H

Annotation: Na/Pi cotransporter II-related (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 44 to 92 (49 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 166 to 199 (34 residues), see Phobius details amino acids 213 to 213 (1 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details PF02690: Na_Pi_cotrans" amino acids 17 to 150 (134 residues), 114.3 bits, see alignment E=4.6e-37 amino acids 163 to 229 (67 residues), 30.2 bits, see alignment E=4.1e-11 PF01895: PhoU" amino acids 344 to 422 (79 residues), 41.2 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 100% identity to rru:Rru_A1871)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT74 at UniProt or InterPro

Protein Sequence (548 amino acids)

>Rru_A1871 Na/Pi cotransporter II-related (NCBI) (Rhodospirillum rubrum S1H)
MTATQTLITLLGEIAFLLWGIHMVHGGVIRAFGTRLQAALAASLRTRFHALIAGVVVTTV
LQSSTATALMATAFAAEGTVTLVSALAVMLGANIGTTLIVQVLSFDITLVFPVLILVGYL
LAKRAGPGRAGPIGQIILGLGFMLLALHLLIETMAPIESAPLLGELLAAITADPLVIALL
AALFTWAAHSSVAAMIFIMTLGDTGAISGETTLAMVLGANLGSAVNPLLESARGDRASRR
LPLGNMINRLVGCALAFPFLGPLSRAMADLDPGMDRMAVNFHTLFNVGLALLFLAPLPLL
ARLLERMVPPRPRANDRGRALYLDTGALDNPGLALSNVAREALHMADVLGGMIEGSRRAF
LSDDEADARAVSREDDILDRLHGQIQRYVGAIDPEGLSADQALRLSNLLSFAINIEHCGD
IIDKTLMDLALKRIRLRATLPGDGMIDIDSLHHRLGVHISLAIAVIMQADHTAARRLVIE
KEEFREIERRATLRHRTHLREGLGADIAASGLTLDIVRDLKRIDSHIAAIAHPLLTETGE
LQVSRLVS