Protein Info for Rru_A1868 in Rhodospirillum rubrum S1H

Annotation: Peptidase M23B (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 45 to 69 (25 residues), see Phobius details amino acids 316 to 331 (16 residues), see Phobius details PF19353: DUF5930" amino acids 159 to 335 (177 residues), 33.1 bits, see alignment E=3.3e-12 PF01551: Peptidase_M23" amino acids 353 to 447 (95 residues), 114.8 bits, see alignment E=1.7e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1868)

Predicted SEED Role

"Membrane proteins related to metalloendopeptidases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT77 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Rru_A1868 Peptidase M23B (NCBI) (Rhodospirillum rubrum S1H)
MSEFDPQDLHLSQVRRLLRRHFPDRHLMVRSDGAMRQFTVTGLHQIGLLVVALGFFGWVT
YATVALVWMDDILSAKNERIDDARDAYKALLAEVGVYKEKVVEVTHSLQGNHAEFNRLLG
TGETREVAAPTAAADGAGNGAGNGAAAGVAGGQDADFLKEQKRYDRERQTLMAQLATLQQ
GMEDLSKAKVLLTDFDGIELEMRKVVLQRDLALAENQDLLKKIRSMESTLLDMKDAQKRL
VDRFGKMAQQRIGALEEDLSATGLDVASLLRRKGRRFQPVGGQGGPFLPVELPAVEDEPA
RDSLDRLNERLDRWGMLNALIFDLPLAAPLATSYRINSPFGVREDPVNGRLSRHEGLDMG
APMDTPVSATGPGKVVYAGWRGRYGRVVEIDHGMGLSTRYAHLRTIKVQLGQSVGRGDVI
GALGNSGRSTGPHLHYEVRVNGNPRNPTVFLKAGKNVFEG