Protein Info for Rru_A1852 in Rhodospirillum rubrum S1H

Annotation: Ribonuclease III (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 TIGR02191: ribonuclease III" amino acids 11 to 220 (210 residues), 224.4 bits, see alignment E=6.2e-71 PF14622: Ribonucleas_3_3" amino acids 18 to 139 (122 residues), 117.8 bits, see alignment E=5.6e-38 PF00636: Ribonuclease_3" amino acids 38 to 128 (91 residues), 73 bits, see alignment E=4.6e-24 PF00035: dsrm" amino acids 154 to 219 (66 residues), 54.5 bits, see alignment E=2.1e-18

Best Hits

Swiss-Prot: 49% identical to RNC_METSB: Ribonuclease 3 (rnc) from Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 100% identity to rru:Rru_A1852)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.3

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT93 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Rru_A1852 Ribonuclease III (NCBI) (Rhodospirillum rubrum S1H)
MARDLNALQIALDHRFTDPALLARALTHRSREGRPSYERLEFLGDRVLGLVVAEMLYARF
PTEDEGALARRHASLVRQDTVARVAQSVGLGELMELSRGEEELGGQFNPSLLCDVCEAVL
GALHLDGGYAKAQRFVEARWAPLMAEDLTPPKDAKTALQEWAQGRGLPLPTYAVEGRDGP
PHKPMFTVSVTVKDNGSESALGASKRLAEQAAAQRLLDRLA