Protein Info for Rru_A1851 in Rhodospirillum rubrum S1H

Annotation: GTP-binding protein Era (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR00231: small GTP-binding protein domain" amino acids 17 to 173 (157 residues), 84 bits, see alignment E=9.8e-28 TIGR00436: GTP-binding protein Era" amino acids 18 to 288 (271 residues), 234.7 bits, see alignment E=1.3e-73 PF00009: GTP_EFTU" amino acids 20 to 182 (163 residues), 48 bits, see alignment E=4.7e-16 PF02421: FeoB_N" amino acids 20 to 174 (155 residues), 53.1 bits, see alignment E=1.1e-17 PF01926: MMR_HSR1" amino acids 20 to 134 (115 residues), 89.8 bits, see alignment E=5.4e-29 PF10662: PduV-EutP" amino acids 21 to 178 (158 residues), 25.5 bits, see alignment E=4.2e-09 PF07650: KH_2" amino acids 217 to 290 (74 residues), 47 bits, see alignment E=7.6e-16

Best Hits

Swiss-Prot: 61% identical to ERA_RHIME: GTPase Era (era) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03595, GTP-binding protein Era (inferred from 100% identity to rru:Rru_A1851)

Predicted SEED Role

"GTP-binding protein Era" in subsystem Bacterial Cell Division or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RT94 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Rru_A1851 GTP-binding protein Era (NCBI) (Rhodospirillum rubrum S1H)
MTDLDCPSPADSAPPRCGFVAVIGAPNAGKSTLVNRLVGSKVTIVSPKVQTTRSRVRGIA
MVGEAQVVFVDTPGIFQPRKRFDRAMVAAAWEGALEADLVLLVIDAHKGITAEVEEILTK
LKATGRRALLALNKVDALERSRLLEMASRLDAALPFEKVFMISALTGSGCDDVLAWLAER
VPAGPWMFPEDEVSDLPQRLLAAEITREKVFLQLHEELPYAAAVVTESWRERADGSVRID
QTVLVQRESQRAIFLGKGGARIKALGRAARVELSEILERPVHLFLHVKVNDRLWDDRDQY
SEWGLDFDV