Protein Info for Rru_A1832 in Rhodospirillum rubrum S1H

Annotation: GTP cyclohydrolase I (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01227: GTP_cyclohydroI
  • amino acids 31 to 208 (178 residues), 231.2 bits, E=3.1e-73
• TIGR00063: GTP cyclohydrolase I
  • amino acids 32 to 209 (178 residues), 199.8 bits, E=1.4e-63

Best Hits

Swiss-Prot: 53% identical to GCH1_AZOC5: GTP cyclohydrolase 1 (folE) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 100% identity to rru:Rru_A1832)

MetaCyc: 47% identical to GTP cyclohydrolase I (Bacillus subtilis subtilis 168)
GTP cyclohydrolase I. [EC: 3.5.4.16]

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (2/4 steps found)
• tetrahydromonapterin biosynthesis (2/4 steps found)
• preQ₀ biosynthesis (1/4 steps found)
• superpathway of chorismate metabolism (37/59 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.16

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

See Q2RTB3 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Rru_A1832 GTP cyclohydrolase I (NCBI) (Rhodospirillum rubrum S1H)
MEKTLLSRAQSGVEAFDATPYYKPVSVGEAEAAIAVLLRYIGEDPTREGLVETPARFIRA
CGHHFAGYAQDPLRILATTFSESAGYAGMILLRDIRFEAFCEHHLAPIIGKAHVAYMPND
RVVGLSKLARVVDVFAKRLQLQERMTMQIATAIEAALAPRGVAVLIESEHHCMSTRGAYK
PGSTMVTSVTTGCFEADGAPRREFFEAVRA