Protein Info for Rru_A1826 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF193 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF22811: Zn_ribbon_NrdR" amino acids 1 to 42 (42 residues), 72.1 bits, see alignment E=2.8e-24 TIGR00244: transcriptional regulator NrdR" amino acids 1 to 147 (147 residues), 177.4 bits, see alignment E=9e-57 PF03477: ATP-cone" amino acids 50 to 136 (87 residues), 80 bits, see alignment E=1.6e-26

Best Hits

Swiss-Prot: 100% identical to NRDR_RHORT: Transcriptional repressor NrdR (nrdR) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K07738, transcriptional repressor NrdR (inferred from 100% identity to rru:Rru_A1826)

Predicted SEED Role

"Ribonucleotide reductase transcriptional regulator NrdR" in subsystem Ribonucleotide reduction

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTB9 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Rru_A1826 Protein of unknown function DUF193 (NCBI) (Rhodospirillum rubrum S1H)
MRCPFCGNGDTQVKDSRPTEDSAAIRRRRFCPACNSRFTTFERVQLRDLVIVKKDGQRSA
FDRDKLARSIRIACRKRPVDEDSIERIVNGIQRRLESSGDTEINSKAVGELVMEGLRGLD
PVAYVRFASVYRNFREAKDFEDFVETLGGSAD