Protein Info for Rru_A1825 in Rhodospirillum rubrum S1H

Annotation: bifunctional deaminase-reductase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR00326: riboflavin biosynthesis protein RibD" amino acids 1 to 353 (353 residues), 328.8 bits, see alignment E=4.1e-102 PF00383: dCMP_cyt_deam_1" amino acids 1 to 94 (94 residues), 53.5 bits, see alignment E=3e-18 PF14437: MafB19-deam" amino acids 41 to 99 (59 residues), 29 bits, see alignment E=1.3e-10 TIGR00227: riboflavin-specific deaminase C-terminal domain" amino acids 141 to 351 (211 residues), 160 bits, see alignment E=6.3e-51 PF01872: RibD_C" amino acids 142 to 351 (210 residues), 139.9 bits, see alignment E=1.4e-44

Best Hits

KEGG orthology group: K11752, diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC: 1.1.1.193 3.5.4.26] (inferred from 100% identity to rru:Rru_A1825)

Predicted SEED Role

"Diaminohydroxyphosphoribosylaminopyrimidine deaminase (EC 3.5.4.26) / 5-amino-6-(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193)" in subsystem Riboflavin, FMN and FAD metabolism (EC 1.1.1.193, EC 3.5.4.26)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.193 or 3.5.4.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTC0 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Rru_A1825 bifunctional deaminase-reductase (NCBI) (Rhodospirillum rubrum S1H)
MRTALGLAARGLGRVWPNPAVGCVLVDAQGRVVGRGWTQPGGRPHAEREALDRAGAAARG
ATAYVTLEPCSHHGKTPPCADALIDAGVVRVVAALGDPDPRVSGRGFAQLRAAGVVVETG
LLVDEARALNLGFLLHRLRGRPLVTLKAATTLDGRIATAGGDSQWITGPQARRYGHLLRA
DHDAIAIGLGTALADDPLLSCRLAGLEDRSPLRVVFDSALALPLGGALVRSADRLPLWII
TTAAATAARRQALVERGAEILEVEADPRGRPTIAGALSALAGQGVTRLLVEGGGHLAAAF
LAADLVDRLAWFRAARLIGGDGLAAVAALGIDRLADSVQFSLEACQTLGDDRLELYARSR
DPLSPAP