Protein Info for Rru_A1820 in Rhodospirillum rubrum S1H

Annotation: Thiamine-monophosphate kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01379: thiamine-phosphate kinase
  • amino acids 5 to 325 (321 residues), 296.4 bits, E=1.1e-92
• PF00586: AIRS
  • amino acids 28 to 140 (113 residues), 86.9 bits, E=1.3e-28
• PF02769: AIRS_C
  • amino acids 153 to 309 (157 residues), 50.2 bits, E=3.4e-17

Best Hits

Swiss-Prot: 42% identical to THIL_SALTY: Thiamine-monophosphate kinase (thiL) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 100% identity to rru:Rru_A1820)

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate salvage I (1/2 steps found)
• superpathway of thiamine diphosphate biosynthesis II (7/11 steps found)
• superpathway of thiamine diphosphate biosynthesis I (6/10 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Sequence Analysis Tools

See Q2RTC5 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Rru_A1820 Thiamine-monophosphate kinase (NCBI) (Rhodospirillum rubrum S1H)
MARRGEFALIGEVFAPLAASCPAALGLGDDAAVLDWRGRGDLVVSADALVCDVHFLADDP
PDTIARKCLRTNLSDMAAMGAKPVGVLLTAALSPALDDAWMEGFARGLGADLADFSVGLL
GGDTVSTPGPAQFSITILGSMDGHVPLTRSAAQVGDDLWVSGTLGDGALGLRVRQGQILG
LAEDLRAHLVERYRLPRPRVGLGLALRGLAHGCMDISDGLCADAGHLCAASRVGLVIDAP
ALPLSEAAATVIADHPALFQAVLGGGDDYELLFTAAVADRDAVAATTAATGVAVTRIGEV
VAGSAVDVRDADGKSVAVVAAGWSHGE