Protein Info for Rru_A1817 in Rhodospirillum rubrum S1H

Annotation: TPR repeat (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 945 transmembrane" amino acids 492 to 507 (16 residues), see Phobius details PF13424: TPR_12" amino acids 720 to 792 (73 residues), 46.5 bits, see alignment 1.9e-15 amino acids 799 to 871 (73 residues), 58.4 bits, see alignment 3.8e-19 PF13176: TPR_7" amino acids 722 to 754 (33 residues), 16.6 bits, see alignment (E = 3.6e-06) amino acids 762 to 789 (28 residues), 14.4 bits, see alignment (E = 1.9e-05) PF13432: TPR_16" amino acids 726 to 791 (66 residues), 21.7 bits, see alignment 1.3e-07 amino acids 806 to 870 (65 residues), 21.1 bits, see alignment 2e-07 PF13181: TPR_8" amino acids 726 to 752 (27 residues), 14.9 bits, see alignment (E = 1.3e-05) amino acids 801 to 829 (29 residues), 17.3 bits, see alignment (E = 2.3e-06) PF13374: TPR_10" amino acids 840 to 871 (32 residues), 16 bits, see alignment (E = 5.6e-06)

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1817)

Predicted SEED Role

"Putative N-acetylgalactosaminyl-diphosphoundecaprenol glucuronosyltransferase" in subsystem Teichuronic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTC8 at UniProt or InterPro

Protein Sequence (945 amino acids)

>Rru_A1817 TPR repeat (NCBI) (Rhodospirillum rubrum S1H)
MARLHPIYSGQSDRPAILFVHGLDGHWLETWRHDACSKDDCWPHWVGEETGCDIWSLEYD
AALSGWLDQAMPLPDQGSQVMDLLASAPALKGKPLVFVTHSLGGILVKTALVYGAEEDRR
FQHIVDHVLGVVFIATPHSGAQLATLARVIKYLLRINPPVGNLEHHDPHLRTLNRRYQTL
VKERGIEGYVYAEKRGVKIGPRGFGGWLRRIEPTVMVVDPGSTDPSLPEIQPISLAEDHI
SICKPPDRQQQIHLSLCHVLKEKIIPLAGDRGMGTTGVGLKLLESGTAQENPAAHMPPGR
LVGPDDNRLSPREGKVYGRKTQENDVLAFLKGSEPVKVVGGVAGVGKTEVCKAALKTWLH
TSPRPVAYYVRVPDRARSADLVLQVGKAVGIENCESLAQLLGVIPVGLYYLDNLESVADD
QEGRNALRDLAQKPGVRILASSRTRLDTIFGAPIEIKCLSAPDALALFRDLWPPTQTLPK
DDELQAFVIGKLGGHALSLVLVARLGMCLSFDALRRRWDEEGAALACDGVEDDTRTSNLT
FNLRLTAEVLAPTPGALSVWVLMALFEEGIPEAVLEEVERRGQWPTLARHRLAVHHLISK
RGDRWFLPPPVARYARYAAVTEQDGFCWRKSRQPILDLFLVFAEKASSFDSSPETLKAKK
WILEFFNTISIVIECELESNVQNKFWLNRMSYFLRDIYQQRIAVSPALLRKLADAGIQPA
NTLRSLGDLASRLGQVDKARSLYEKALGLSQQEQSGLGQANALKALGDLASRLGQVDKAR
SLYETALGLFQQEQHGLGQANTLHGLGDLASQLGQVDKARSLYEKALGLFQQEPNGLGQA
NTLKSLGALEYRLGQVDKARSLYEKAVDLYRIEQEPLGLAYSLTNLALCFEVLKNLSKRN
QVLKAAFVASRDANNEIVQIYLKEAIPEMPGADVLYDSWLKGQSR