Protein Info for Rru_A1806 in Rhodospirillum rubrum S1H

Annotation: MotA/TolQ/ExbB proton channel (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details PF01618: MotA_ExbB" amino acids 108 to 218 (111 residues), 82.7 bits, see alignment E=9.6e-28

Best Hits

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 100% identity to rru:Rru_A1806)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTD9 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Rru_A1806 MotA/TolQ/ExbB proton channel (NCBI) (Rhodospirillum rubrum S1H)
MSLATILGVLFGFGLFCLSVILSTDNYLLFLKGESFIMVVGGTLAAAFVSFEPRYVVSAL
RSMVAILFNHEVSRSILTHEVGRVIRWGYIIQKNGLPGLEADAQKVRKQDRFLSYGLDLV
VTGYTGTEVREILANTVENTFQRQVVPAEILRNMGGTAPAFGMIGTLVGLIIMFDSMGSN
PGSMGAGLAVALTATLYGLLSARLLFLPAASKVKQREELIRYRNYLLAEGLALLAERKSP
RYIQDRMNSYLDPSIHFSIDRVRIKE