Protein Info for Rru_A1804 in Rhodospirillum rubrum S1H

Annotation: N-acetyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 913 PF13380: CoA_binding_2" amino acids 26 to 152 (127 residues), 83.1 bits, see alignment E=8.3e-27 PF02629: CoA_binding" amino acids 26 to 116 (91 residues), 42.1 bits, see alignment E=4.8e-14 PF13607: Succ_CoA_lig" amino acids 169 to 305 (137 residues), 191.6 bits, see alignment E=2.1e-60 PF19045: Ligase_CoA_2" amino acids 319 to 451 (133 residues), 30.2 bits, see alignment E=1.8e-10 PF13549: ATP-grasp_5" amino acids 498 to 719 (222 residues), 301.3 bits, see alignment E=1.4e-93 PF13302: Acetyltransf_3" amino acids 751 to 889 (139 residues), 30.8 bits, see alignment E=1.8e-10 PF00583: Acetyltransf_1" amino acids 790 to 888 (99 residues), 40.5 bits, see alignment E=1.2e-13 PF13508: Acetyltransf_7" amino acids 805 to 889 (85 residues), 27.7 bits, see alignment E=1.2e-09

Best Hits

KEGG orthology group: K09181, hypothetical protein (inferred from 100% identity to rru:Rru_A1804)

Predicted SEED Role

"Protein acetyltransferase" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTE1 at UniProt or InterPro

Protein Sequence (913 amino acids)

>Rru_A1804 N-acetyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MGAEPSAGVGRRPMSVRNLSALFAPRSVAVIGASNQANTVGHLVMRNLLSGGFGGPIMPV
NPKYQAVGGVLAYADVASLPVAPDLAIVCSPPDSVPMAVAELGDRGTKACIVMTEGLSRA
REAGGRSLQQATLDAARRHMVRVLGPNSVGLLVPALGLNASFSHQPALPGKAAFISQSGA
LCTAVLDWAKGRGIGFSHFVSLGDKADVDFGDAVDYLGAQPDVRAVLLYIETLTDARKFM
SAARSAARNKPVIVIKSGRGEEGARAAASHTGNLAGTDSIHDIAFKRAGMLRVYSLEELF
SAVETIAHTRRPMRGERLAILTNGGGIGVMAVDELSDRGGTLAKLSPETLARLHTVVPAS
TVVANPLNIGGSAPGERYTAALEVLLDSHDVDAVLVMHAPSAFSSPSDIARKVIDVARAR
RTASIFTCWVGQASVTEARGLFAEAQIPTFSTPDEGVQGFMHMVDYRRNQDMLMETPPSL
PSEFTANTNSARTIVDLAIERGHLIMSEPEAKAVFAAYGIPTVETHIAHTAEEAEDVARR
MNGPVALKILSRDITHKSDVGGVVLDLDHPETVRKAAEDMIGRVTATFPGARLEGFTVQR
MARRPGAHELIVGATTDPIFGPVILFGQGGTAVEIIRDRSVALPPLNMALAHDMLERTRV
FRLLEGYRDKPAADIESICVTLIQVAQMMIDIPEIVELEINPLFADSRGVLAVDARVRLE
PGKTKGPHRLAIRPYPKQLEETFTMTDGRAVVLRPIRPEDEPKHHEFVSRLTAEDVRFRF
FGLVKELPHDQMARLTQIDYAREMAFVAQLDEGGARQTLGVVRAVTDPDNETTEFSVVVR
SDLKGSGLGKALMKKIIRYCQERRTKAMVGQVLRDNRRMLKFCEGLGFERIGIVDDDVVE
LKLDLAKVNLNAT