Protein Info for Rru_A1793 in Rhodospirillum rubrum S1H

Annotation: Secretion protein HlyD (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 49 to 95 (47 residues), 32.8 bits, see alignment 6.9e-12 PF16576: HlyD_D23" amino acids 185 to 297 (113 residues), 53.7 bits, see alignment E=2.7e-18 PF13437: HlyD_3" amino acids 212 to 296 (85 residues), 52.1 bits, see alignment E=1.4e-17

Best Hits

Swiss-Prot: 59% identical to Y5573_RHIME: UPF0194 membrane protein RB0873 (RB0873) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 100% identity to rru:Rru_A1793)

Predicted SEED Role

"Predicted membrane fusion protein (MFP) component of efflux pump, membrane anchor protein YbhG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTF2 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Rru_A1793 Secretion protein HlyD (NCBI) (Rhodospirillum rubrum S1H)
MKKRLLGGVLGLVILGGGLAVWGDIPRRLGWGGEGEDRLTLYGNVDIRQVQLGFRVSGRI
DQAMVDEGDFVTEGTVLARLDVAPYDDAVRAAEAGVGERQASLDKRVAGPRPAEIAQAKA
VYAEHLANLTYARQDFDKADKLLPSGAVSRSLFDHAQAQRGVALARVDAAREALRLLEEG
TRAEDIAAARASLLAAQADLSSARTARRDTELKAPADGVILSRVREPGAIVASGDIVYVM
SLKAPVWVRAYVSESNLGRVYPGLPVEVLTDGAPHKPYRGTVGFISPVAEFTPKTVETPD
LRTDLVYRLRVVIAQADDGLRQGMPVTLRLAPPGSPQALPSSSPSPR