Protein Info for Rru_A1764 in Rhodospirillum rubrum S1H

Annotation: SecD export membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 324 to 346 (23 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details amino acids 422 to 444 (23 residues), see Phobius details amino acids 451 to 478 (28 residues), see Phobius details PF07549: Sec_GG" amino acids 41 to 63 (23 residues), 20.8 bits, see alignment (E = 4.4e-08) PF21760: SecD_1st" amino acids 151 to 206 (56 residues), 39.1 bits, see alignment 8.3e-14 PF22599: SecDF_P1_head" amino acids 211 to 304 (94 residues), 35.2 bits, see alignment E=1.9e-12 TIGR01129: protein-export membrane protein SecD" amino acids 211 to 474 (264 residues), 249.4 bits, see alignment E=6.9e-78 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 260 to 466 (207 residues), 188 bits, see alignment E=1.9e-59 PF02355: SecD_SecF_C" amino acids 308 to 477 (170 residues), 49 bits, see alignment E=1e-16

Best Hits

KEGG orthology group: K03072, preprotein translocase subunit SecD (inferred from 100% identity to rru:Rru_A1764)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTI1 at UniProt or InterPro

Protein Sequence (488 amino acids)

>Rru_A1764 SecD export membrane protein (NCBI) (Rhodospirillum rubrum S1H)
MPALFSLWKAIPVILVVLAGITFSLANVVPGAGEGGLRWWRPLSLGLDLKGGSTFLIDLD
APALVHETQVALAASAGAALRGERIGGAANLGEDGAVVVDIADAGQRAAALRLLRGLEAG
TEAEITPAGAIRLTFTAIAQAERTDRMVARGLGVLRQRLREAGLSEIRLERRSDRRILVA
LPGLDDSERVRDLLWRPARLSIRAANGEGGTIDGDRLTSAQATVQNGKPLISLRFDGVGE
RRIIQMRGGEGGERGLEATIDGEAVAVRLLRQPGSGGIGLLLDGAFSTRAAQDLALMLRV
GALPTPFRIVEERTVGPSLGADRVAAGALASAAGALAVTVFLIAVYGLFGVFATIALGLN
FCLLFGMLSGLGATLTLPGIAGIALTIGMAVDASVLIFERIGEEARAGLAVDEALRAGFG
KAFSAVLDANILTLGVGALLFWLGGGPVRGFAVTLTLGAVSALFTAMLLNRLIVALWLRL
ARPKTIPL