Protein Info for Rru_A1753 in Rhodospirillum rubrum S1H

Annotation: High-affinity nickel-transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 8 to 29 (22 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details amino acids 294 to 318 (25 residues), see Phobius details PF03824: NicO" amino acids 72 to 168 (97 residues), 56.6 bits, see alignment E=1.4e-19 amino acids 197 to 319 (123 residues), 40.4 bits, see alignment E=1.2e-14

Best Hits

KEGG orthology group: K08970, nickel/cobalt exporter (inferred from 100% identity to rru:Rru_A1753)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTJ2 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Rru_A1753 High-affinity nickel-transporter (NCBI) (Rhodospirillum rubrum S1H)
MIGRHHPILAWAAVVAIGGGVIVLGGIGLPGAGDWLSDWTRAITSRQAGFHRELGQAVRD
LAGEGGGAAGVGLLIASLGYGVFHALGPGHGKAVIGAYAATTATGFRRAALLSLAAALIQ
ATTAVVLVDGAFLVMRGGAHWANRTAERWLEPASYAAILGLGLYLGGRGLLAIVRAGRPS
PGGDHRPTHPGQARDEEACAHCGHAHGPTADQVAKATEWRSAAMIALAVGIRPCSGAILV
LVVANGLGLWAAGILAAYVMALGTAATVALLAVGARASRLPIAGLARRLPLSPALLGGLA
GTLAGLILVVLAGLLLRASLLAPVHPLLG