Protein Info for Rru_A1750 in Rhodospirillum rubrum S1H

Annotation: inner-membrane translocator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 32 to 59 (28 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 134 to 180 (47 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details amino acids 371 to 398 (28 residues), see Phobius details amino acids 408 to 425 (18 residues), see Phobius details PF11862: DUF3382" amino acids 28 to 125 (98 residues), 64.1 bits, see alignment E=1.2e-21 PF02653: BPD_transp_2" amino acids 135 to 421 (287 residues), 180.6 bits, see alignment E=3.6e-57

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to rru:Rru_A1750)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTJ5 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Rru_A1750 inner-membrane translocator (NCBI) (Rhodospirillum rubrum S1H)
MAQAPLNAKAGAGAGGLQIGWVNVPKLIKESLITAALAAVLFLPFIALHATSSGAGLFIE
QRWETWGWSVLTVFIGRIALVIWRDNPSNRLHDALLKSVVMPVGGFFRRNMAFIGLAALV
LAIVFPITPFSNRYYVDVATTWMIYIMLGWGLNIVVGLAGLLDLGYVAFYAVGAYSYALL
SQTFGWSFWVCLPLAGVFAAFFGVVLGFPVLRLRGDYLAIVTLGFGEIIRVVLLNWYAVT
NGPDGISGIERPSFFGLDFARTAPEGGETFHQFFGISYSPDHRVIFLFYLILALAVLTNI
FTGRIRRLPVGRAWEALREDEIACRSLGINPTNVKLSAFALGAMFGGFAGSFFATRQGFI
SPESFTFMESAVILAIVVLGGMGSQIGVVIAAFFLVVLPEVFREFDQFRMFFFGAAMVAV
MVWRPRGLLSYRDPTILFEKIKHRLAKQGGKA