Protein Info for Rru_A1746 in Rhodospirillum rubrum S1H

Annotation: Extracellular ligand-binding receptor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13433: Peripla_BP_5" amino acids 26 to 344 (319 residues), 67 bits, see alignment E=2.7e-22 PF13458: Peripla_BP_6" amino acids 26 to 361 (336 residues), 206.1 bits, see alignment E=1.8e-64 PF01094: ANF_receptor" amino acids 48 to 360 (313 residues), 121.8 bits, see alignment E=5.3e-39

Best Hits

Swiss-Prot: 57% identical to LIVB1_BRUSU: Leu/Ile/Val-binding protein homolog 1 (BR1785) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to rru:Rru_A1746)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTJ9 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Rru_A1746 Extracellular ligand-binding receptor (NCBI) (Rhodospirillum rubrum S1H)
MNKFQTGLLAATAAFAMGVGSAQADITVGVAGPMTGQYASFGEQLAKGAEQAVKDINAKG
GVLGEKLVLKKGDDACDPKQAVAVANQFVNDKVVFVAGHFCSGSSIPASAVYNEEGIVQI
SPASTNPKLTEQGFENVFRTCGRDDQQGPTAGDFLKAHFPGQKIAIIHDKTAYGKGLADE
TKSALNKAGVQEALYEAITAGEKDYSALVTKLKNEGIKIIYLGGYHTEAGLIIRQAKEQG
LDARIVSGDALVSSEFASIAGPAGDGTLFTFSPDPRKNPEAAAVVKSFTDAGYNAEGYTL
YTYGAVQAWAQAVEKAKSTDVDKVAKALKSGQFSTVLGPIGFDAQGDVSAPGYVMYEWKG
GNYDYFKN