Protein Info for Rru_A1745 in Rhodospirillum rubrum S1H

Annotation: Single-strand binding protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR00621: single-stranded DNA-binding protein" amino acids 3 to 185 (183 residues), 157.1 bits, see alignment E=2.5e-50 PF00436: SSB" amino acids 5 to 104 (100 residues), 126.7 bits, see alignment E=1.8e-41

Best Hits

Swiss-Prot: 60% identical to SSB_RHOS4: Single-stranded DNA-binding protein (ssb) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K03111, single-strand DNA-binding protein (inferred from 100% identity to rru:Rru_A1745)

MetaCyc: 53% identical to ssDNA-binding protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTK0 at UniProt or InterPro

Protein Sequence (185 amino acids)

>Rru_A1745 Single-strand binding protein (NCBI) (Rhodospirillum rubrum S1H)
MAGSVNKVILIGNLGKDPETRTFQNGGKVTNLRIATSETWKDRQSGERRERTEWHQVAVF
GPLADIAERYLRKGSKVYLCGSLQTRKWQDQQGQDRYTTEIVLQGPGAEMTMLDGKPGAG
DDYQGGAGAGGGYGQGGGGYGAGAGAAAGGGYGGGAAGGGRQGWDTAPASGPAGGPVDMD
DDIPF