Protein Info for Rru_A1725 in Rhodospirillum rubrum S1H

Annotation: Carbonate dehydratase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00194: Carb_anhydrase
  • amino acids 44 to 256 (213 residues), 131.9 bits, E=1.6e-42

Best Hits

Swiss-Prot: 43% identical to CAH_NOSS1: Carbonic anhydrase (ecaA) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: K01674, carbonic anhydrase [EC: 4.2.1.1] (inferred from 100% identity to rru:Rru_A1725)

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

• 3-hydroxypropanoate cycle (10/13 steps found)
• cyanate degradation (2/3 steps found)
• CO₂ fixation into oxaloacetate (anaplerotic) (1/2 steps found)
• superpathway of the 3-hydroxypropanoate cycle (12/18 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (6/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• glyoxylate assimilation (7/13 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (7/14 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

See Q2RTM0 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Rru_A1725 Carbonate dehydratase (NCBI) (Rhodospirillum rubrum S1H)
MVMQRAFSHAAMAVAFGLVGFSGAPAVAAETAHPPHWAYEGKGGPVDWGALSEDYHACAA
GKEQSPVDIRDAIPAKLPAIAPAYQAQSAVVVNNGHTLQVNVSPGSSLDFRGQRYELLQY
HFHHPSEHLVNGKAAPLELHLVHKGPTALTVIGVMLVPGAANPAIEAIWKVAPAKEGGEA
TLGDPGPDLGKLLPESKSYTFYEGSLTTPPCSEVVNWINLKTPVTVSEDQIARFAALFPM
NARPPQALHRRIILESQDQ