Protein Info for Rru_A1716 in Rhodospirillum rubrum S1H

Annotation: YeeE/YedE (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details PF04143: Sulf_transp" amino acids 5 to 124 (120 residues), 30.2 bits, see alignment E=1.8e-11

Best Hits

Swiss-Prot: 59% identical to Y1892_XYLFT: UPF0394 membrane protein PD_1892 (PD_1892) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K07112, (no description) (inferred from 100% identity to rru:Rru_A1716)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTM9 at UniProt or InterPro

Protein Sequence (135 amino acids)

>Rru_A1716 YeeE/YedE (NCBI) (Rhodospirillum rubrum S1H)
MSVFWPPLLGGMLLGLSAALLLIGNGKVAGISGMAGRLLQGQSRVESAVFLIGLLLGPAL
YALIVGAWPAVTIVASWPVIVIAGLLVGFGTRMGSGCTSGHGIVGLARLSRRSLAATATF
LVCGVLTASLMGILR